Anti-C3a R Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A9843-50
Article Name: Anti-C3a R Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A9843-50
Supplier Catalog Number: A9843-50
Alternative Catalog Number: ABC-A9843-50
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 161-337 of human C3AR1 (NP_004045.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to C3a R.
Clonality: Polyclonal
Molecular Weight: 50 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: REIFTTDNHNRCGYKFGLSSSLDYPDFYGDPLENRSLENIVQPPGEMNDRLDPSSFQTNDHPWTVPTVFQPQTFQRPSADSLPRGSARLTSQNLYSNVFKPADVVSPKIPSGFPIEDHETSPLDNSDAFLSTHLKLFPSASSNSFYESELPQGFQDYYNLGQFTDDDQVPTPLVAIT
Target: C3a R
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:1,000