Anti-Drebrin Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A9845-50
Article Name: Anti-Drebrin Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A9845-50
Supplier Catalog Number: A9845-50
Alternative Catalog Number: ABC-A9845-50
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 350-649 of human DBN1 (NP_004386.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to Drebrin.
Clonality: Polyclonal
Molecular Weight: 110 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: EQIERALDEVTSSQPPPLPPPPPPAQETQEPSPILDSEETRAAAPQAWAGPMEEPPQAQAPPRGPGSPAEDLMFMESAEQAVLAAPVEPATADATEIHDAADTIETDTATADTTVANNVPPAATSLIDLWPGNGEGASTLQGEPRAPTPPSGTEVTLAEVPLLDEVAPEPLLPAGEGCATLLNFDELPEPPATFCDPEEVEGEPLAAPQTPTLPSALEELEQEQEPEPHLLTNGETTQKEGTQASEGYFSQSQE
Target: Drebrin
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, ICC/IF: 1:50-1:100