Anti-Lysosomal acid lipase / LAL Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A9847-100
Article Name: Anti-Lysosomal acid lipase / LAL Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A9847-100
Supplier Catalog Number: A9847-100
Alternative Catalog Number: ABC-A9847-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 110-399 of human LIPA (NP_001121077.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to Lysosomal acid lipase / LAL.
Clonality: Polyclonal
Molecular Weight: 40 - 45 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: DAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVYTTHSPAGTSVQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADVYDVNILLTQITNL
Target: Lysosomal acid lipase / LAL
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, IHC: 1:50-1:200