Anti-TCN1 Antibody - Identical to Abcam (ab202121), Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A9856-100
Article Name: Anti-TCN1 Antibody - Identical to Abcam (ab202121), Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A9856-100
Supplier Catalog Number: A9856-100
Alternative Catalog Number: ABC-A9856-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 24-280 of human TCN1 (NP_001053.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to TCN1.
Clonality: Polyclonal
Molecular Weight: 48 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: EICEVSEENYIRLKPLLNTMIQSNYNRGTSAVNVVLSLKLVGIQIQTLMQKMIQQIKYNVKSRLSDVSSGELALIILALGVCRNAEENLIYDYHLIDKLENKFQAEIENMEAHNGTPLTNYYQLSLDVLALCLFNGNYSTAEVVNHFTPENKNYYFGSQFSVDTGAMAVLALTCVKKSLINGQIKADEGSLKNISIYTKSLVEKILSEKKENGLIGNTFSTGEAMQALFVSSDYYNENDWNCQQTLNTVLTEIS
Target: TCN1
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000