Anti-Tetranectin Antibody - Identical to Abcam (ab202134), Unconjugated, Rabbit, Polyclonal
Catalog Number:
ABC-A9859-50
| Article Name: |
Anti-Tetranectin Antibody - Identical to Abcam (ab202134), Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: |
ABC-A9859-50 |
| Supplier Catalog Number: |
A9859-50 |
| Alternative Catalog Number: |
ABC-A9859-50 |
| Manufacturer: |
Antibodies.com |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
ICC |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 22-202 of human CLEC3B/Tetranectin (NP_003269.2). |
| Conjugation: |
Unconjugated |
| Rabbit polyclonal antibody to Tetranectin. |
| Clonality: |
Polyclonal |
| Buffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide. |
| Form: |
Liquid |
| Sequence: |
EPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVCLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLGTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV |
| Target: |
Tetranectin |
| Antibody Type: |
Primary Antibody |
| Application Dilute: |
ICC/IF: 1:10-1:100 |
