Anti-RAMP1 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A9872-100
Article Name: Anti-RAMP1 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A9872-100
Supplier Catalog Number: A9872-100
Alternative Catalog Number: ABC-A9872-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-148 of human RAMP1 (NP_005846.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to RAMP1.
Clonality: Polyclonal
Molecular Weight: 17 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: AVGETLWCDWGRTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGSILYPFIVVPITVTLLVTALVVWQSKRTEGIV
Target: RAMP1
Antibody Type: Primary Antibody
Application Dilute: WB: 1:100-1:500, ICC/IF: 1:50-1:200