Anti-POLR3K Antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
ABC-A9882-100
Article Name: |
Anti-POLR3K Antibody, Unconjugated, Rabbit, Polyclonal |
Biozol Catalog Number: |
ABC-A9882-100 |
Supplier Catalog Number: |
A9882-100 |
Alternative Catalog Number: |
ABC-A9882-100 |
Manufacturer: |
Antibodies.com |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Human |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-108 of human POLR3K (NP_057394.3). |
Conjugation: |
Unconjugated |
Rabbit polyclonal antibody to POLR3K. |
Clonality: |
Polyclonal |
Molecular Weight: |
12kDa |
Buffer: |
Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol. |
Sequence: |
MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD |
Target: |
POLR3K |
Antibody Type: |
Primary Antibody |
Application Dilute: |
WB: 1:500-1:2000 |