Anti-POLR3K Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A9882-50
Article Name: Anti-POLR3K Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A9882-50
Supplier Catalog Number: A9882-50
Alternative Catalog Number: ABC-A9882-50
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-108 of human POLR3K (NP_057394.3).
Conjugation: Unconjugated
Rabbit polyclonal antibody to POLR3K.
Clonality: Polyclonal
Molecular Weight: 12kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.
Sequence: MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD
Target: POLR3K
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2000