Anti-Claudin 2 Antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
ABC-A9915-50
| Article Name: |
Anti-Claudin 2 Antibody, Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: |
ABC-A9915-50 |
| Supplier Catalog Number: |
A9915-50 |
| Alternative Catalog Number: |
ABC-A9915-50 |
| Manufacturer: |
Antibodies.com |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
ICC, WB |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 30-230 of human CLDN2 (NP_001164566.1). |
| Conjugation: |
Unconjugated |
| Rabbit polyclonal antibody to Claudin 2. |
| Clonality: |
Polyclonal |
| Molecular Weight: |
20 kDa |
| Buffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide. |
| Form: |
Liquid |
| Sequence: |
WKTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAISSLACIISVVGMRCTVFCQESRAKDRVAVAGGVFFILGGLLGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLIAGIILCFSCSSQRNRSNYYDAYQAQPLATRSSPRPGQPPKVKSEFNSYSLTGYV |
| Target: |
Claudin 2 |
| Antibody Type: |
Primary Antibody |
| Application Dilute: |
WB: 1:100-1:500, ICC/IF: 1:50-1:100 |
