Anti-GALNT3 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A9929-100
Article Name: Anti-GALNT3 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A9929-100
Supplier Catalog Number: A9929-100
Alternative Catalog Number: ABC-A9929-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human GALNT3 (NP_004473.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to GALNT3.
Clonality: Polyclonal
Molecular Weight: 73kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.
Sequence: MAHLKRLVKLHIKRHYHKKFWKLGAVIFFFIIVLVLMQREVSVQYSKEESRMERNMKNKNKMLDLMLEAVNNIKDAMPKMQIGAPVRQNIDAGERPCLQGYYTAAELKPVLDRPPQDSNAPGASGKAFKTTNLSVEEQKE
Target: GALNT3
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2000