Anti-GALNT3 Antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
ABC-A9929-50
Article Name: |
Anti-GALNT3 Antibody, Unconjugated, Rabbit, Polyclonal |
Biozol Catalog Number: |
ABC-A9929-50 |
Supplier Catalog Number: |
A9929-50 |
Alternative Catalog Number: |
ABC-A9929-50 |
Manufacturer: |
Antibodies.com |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Human |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human GALNT3 (NP_004473.2). |
Conjugation: |
Unconjugated |
Rabbit polyclonal antibody to GALNT3. |
Clonality: |
Polyclonal |
Molecular Weight: |
73kDa |
Buffer: |
Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol. |
Sequence: |
MAHLKRLVKLHIKRHYHKKFWKLGAVIFFFIIVLVLMQREVSVQYSKEESRMERNMKNKNKMLDLMLEAVNNIKDAMPKMQIGAPVRQNIDAGERPCLQGYYTAAELKPVLDRPPQDSNAPGASGKAFKTTNLSVEEQKE |
Target: |
GALNT3 |
Antibody Type: |
Primary Antibody |
Application Dilute: |
WB: 1:500-1:2000 |