Anti-GLP2R Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A9933-100
Article Name: Anti-GLP2R Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A9933-100
Supplier Catalog Number: A9933-100
Alternative Catalog Number: ABC-A9933-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 460-553 of human GLP2R (NP_004237.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to GLP2R.
Clonality: Polyclonal
Molecular Weight: 63 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Form: Liquid
Sequence: SGCRACVLGKDFRFLGKCPKKLSEGDGAEKLRKLQPSLNSGRLLHLAMRGLGELGAQPQQDHARWPRGSSLSECSEGDVTMANTMEEILEESEI
Target: GLP2R
Antibody Type: Primary Antibody
Application Dilute: WB: 1:100-1:500, IHC: 1:50-1:200