Anti-IL-9R Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A9948-50
Article Name: Anti-IL-9R Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A9948-50
Supplier Catalog Number: A9948-50
Alternative Catalog Number: ABC-A9948-50
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human IL9R (XP_011529456.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to IL-9R.
Clonality: Polyclonal
Molecular Weight: 57 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: PELGQGSSPWLLFTSNQAPGGTHKCILRGSECTVVLPPEAVLVPSDNFTITFHHCMSGREQVSLVDPEYLPRRHVKLDPPSDLQSNISSGHCILTWSISPA
Target: IL-9R
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, IHC: 1:100-1:200