Anti-MLPH Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A9955-100
Article Name: Anti-MLPH Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A9955-100
Supplier Catalog Number: A9955-100
Alternative Catalog Number: ABC-A9955-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 301-600 of human MLPH (NP_077006.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to MLPH.
Clonality: Polyclonal
Molecular Weight: 75 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: EQLPLQYLADVDTSDEESIRAHVMASHHSKRRGRASSESQIFELNKHISAVECLLTYLENTVVPPLAKGLGAGVRTEADVEEEALRRKLEELTSNVSDQETSSEEEEAKDEKAEPNRDKSVGPLPQADPEVGTAAHQTNRQEKSPQDPGDPVQYNRTTDEELSELEDRVAVTASEVQQAESEVSDIESRIAALRAAGLTVKPSGKPRRKSNLPIFLPRVAGKLGKRPEDPNADPSSEAKAMAVPYLLRRKFSNS
Target: MLPH
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200