Anti-Nmnat1 / NMNAT Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A9962-100
Article Name: Anti-Nmnat1 / NMNAT Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A9962-100
Supplier Catalog Number: A9962-100
Alternative Catalog Number: ABC-A9962-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human NMNAT1 (NP_073624.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to Nmnat1 / NMNAT.
Clonality: Polyclonal
Molecular Weight: 32 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: MENSEKTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTLERPGRKRKWTETQDSSQKKSLEPKTKAVPK
Target: Nmnat1 / NMNAT
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:1,000