Anti-NNMT Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A9963-100
Article Name: Anti-NNMT Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A9963-100
Supplier Catalog Number: A9963-100
Alternative Catalog Number: ABC-A9963-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-264 of human NNMT (NP_006160.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to NNMT.
Clonality: Polyclonal
Molecular Weight: 28 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFS
Target: NNMT
Antibody Type: Primary Antibody
Application Dilute: WB: 1:100-1:500, ICC/IF: 1:50-1:200