Anti-Pannexin 1 Antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
ABC-A9966-50
Article Name: |
Anti-Pannexin 1 Antibody, Unconjugated, Rabbit, Polyclonal |
Biozol Catalog Number: |
ABC-A9966-50 |
Supplier Catalog Number: |
A9966-50 |
Alternative Catalog Number: |
ABC-A9966-50 |
Manufacturer: |
Antibodies.com |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Human, Mouse |
Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Pannexin 1 (NP_056183.2). |
Conjugation: |
Unconjugated |
Rabbit polyclonal antibody to Pannexin 1. |
Clonality: |
Polyclonal |
Molecular Weight: |
54 kDa |
Buffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide. |
Form: |
Liquid |
Sequence: |
ISLAFAQEISIGTQISCFSPSSFSWRQAAFVDSYCWAAVQQKNSLQSESGNLPLWLHKFFPYILLLFAILLYLPPLFWRFAAAPHICSDLKFIMEELDKVY |
Target: |
Pannexin 1 |
Antibody Type: |
Primary Antibody |
Application Dilute: |
WB: 1:500-1:2,000 |