Anti-PLA2G2D Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A9969-50
Article Name: Anti-PLA2G2D Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A9969-50
Supplier Catalog Number: A9969-50
Alternative Catalog Number: ABC-A9969-50
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: IF, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 21-145 of human PLA2G2D (NP_036532.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to PLA2G2D.
Clonality: Polyclonal
Molecular Weight: 20kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.
Sequence: GILNLNKMVKQVTGKMPILSYWPYGCHCGLGGRGQPKDATDWCCQTHDCCYDHLKTQGCSIYKDYYRYNFSQGNIHCSDKGSWCEQQLCACDKEVAFCLKRNLDTYQKRLRFYWRPHCRGQTPGC
Target: PLA2G2D
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2000, IHC: 1:50-1:200, IF: 1:10-1:100