Anti-Scramblase 1 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A9970-100
Article Name: Anti-Scramblase 1 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A9970-100
Supplier Catalog Number: A9970-100
Alternative Catalog Number: ABC-A9970-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-318 of human Phospholipid Scramblase 1 (Phospholipid Scramblase 1 (PLSCR1)) (NP_066928.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to Scramblase 1.
Clonality: Polyclonal
Molecular Weight: 35 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPPAGHSGPGPAGFPVPNQPVYNQPVYNQPVGAAGVPWMPAPQPPLNCPPGLEYLSQIDQILIHQQIELLEVLTGFETNNKYEIKNSFGQRVYFAAEDTDCCTRNCCGPSRPFTLRIIDNMGQEVITLERPLRCSSCCCPCCLQEIEIQAPPGVPIGYVIQTWHPCLPKFTIQNEKREDVLKISGPCVVCSCCGDVDFEIKSLDEQC
Target: Scramblase 1
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000