Anti-PNPLA3 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A9972-100
Article Name: Anti-PNPLA3 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A9972-100
Supplier Catalog Number: A9972-100
Alternative Catalog Number: ABC-A9972-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 377-481 of human PNPLA3 (NP_079501.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to PNPLA3.
Clonality: Polyclonal
Molecular Weight: 53 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: PDMPDDVLWLQWVTSQVFTRVLMCLLPASRSQMPVSSQQASPCTPEQDWPCWTPCSPKGCPAETKAEATPRSILRSSLNFFLGNKVPAGAEGLSTFPSFSLEKSL
Target: PNPLA3
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000