Anti-SLC26A3 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A9985-50
Article Name: Anti-SLC26A3 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A9985-50
Supplier Catalog Number: A9985-50
Alternative Catalog Number: ABC-A9985-50
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 505-764 of human SLC26A3 (NP_000102.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to SLC26A3.
Clonality: Polyclonal
Molecular Weight: 85 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: FPKCSTLANIGRTNIYKNKKDYYDMYEPEGVKIFRCPSPIYFANIGFFRRKLIDAVGFSPLRILRKRNKALRKIRKLQKQGLLQVTPKGFICTVDTIKDSDEELDNNQIEVLDQPINTTDLPFHIDWNDDLPLNIEVPKISLHSLILDFSAVSFLDVSSVRGLKSILQEFIRIKVDVYIVGTDDDFIEKLNRYEFFDGEVKSSIFFLTIHDAVLHILMKKDYSTSKFNPSQEKDGKIDFTINTNGGLRNRVYEV
Target: SLC26A3
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000