Anti-TREX1 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A9994-100
Article Name: Anti-TREX1 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A9994-100
Supplier Catalog Number: A9994-100
Alternative Catalog Number: ABC-A9994-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 172-314 of human TREX1 (NP_338599.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to TREX1.
Clonality: Polyclonal
Molecular Weight: 35 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: GPRKSYSLGSIYTRLYGQSPPDSHTAEGDVLALLSICQWRPQALLRWVDAHARPFGTIRPMYGVTASARTKPRPSAVTTTAHLATTRNTSPSLGESRGTKDLPPVKDPGALSREGLLAPLGLLAILTLAVATLYGLSLATPGE
Target: TREX1
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:1,000, ICC/IF: 1:50-1:200