Anti-UQCRFS1 / RISP Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A9995-100
Article Name: Anti-UQCRFS1 / RISP Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A9995-100
Supplier Catalog Number: A9995-100
Alternative Catalog Number: ABC-A9995-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 141-274 of human UQCRFS1 (NP_005994.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to UQCRFS1 / RISP.
Clonality: Polyclonal
Molecular Weight: 23 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Form: Liquid
Sequence: SASADVLALAKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTQKEIEQEAAVELSQLRDPQHDLDRVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGPAPLNLEVPTYEFTSDDMVIVG
Target: UQCRFS1 / RISP
Antibody Type: Primary Antibody
Application Dilute: WB: 1:100-1:500, IHC: 1:50-1:200