PD-L2 Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human Programmed Death- Ligand 2 (PD-L2, also known as B7-DC and CD273). Sequence data: hPD-L2 (accession number NP_079515) MIFLLLMLSLELQLHQIAALFTVTVPKELYIIEHGSNVTLECNFDTGSHV
Application Dilute:
Application:. Screen for antibodies of human PD-L2 through Flow Cytometry. Culture conditions: Cells should be grown at 37C with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated FBS and
* VAT and and shipping costs not included. Errors and price changes excepted