ICOS Stable Cell Line

Catalog Number: ABI-14-503ACL
Article Name: ICOS Stable Cell Line
Biozol Catalog Number: ABI-14-503ACL
Supplier Catalog Number: 14-503ACL
Alternative Catalog Number: ABI-14-503ACL-1VIAL
Manufacturer: Abeomics
Category: Zellen/Zellkultur
Application: FA
ICOS Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human Inducible T-Cell Costimulator (ICOS, also known as CD278). Sequence data: hICOS (accession number NP_036224) MKSGLWYFFLFCLRIKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQ
Application Dilute: Application:. Screen for antibodies of human ICOS through Flow Cytometry. Culture conditions: Cells should be grown at 37C with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated FBS and