mCD73 Stable Cell Line is a stably transfected CHO-K1 cell line which expresses mouse Cluster of Differentiation 73 (CD73 also known as ecto-5 -nucleotidase). Sequence data: mCD73 (accession number NP_035981) MRPAAAKVPKWLLLALSALLPQWPAASAWELTILHTNDVHSRLEQ
Application Dilute:
Application:. Screen for antibodies of mouse CD73 through Flow Cytometry. Culture condition Cells should be grown at 37C with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated FBS and 1%
* VAT and and shipping costs not included. Errors and price changes excepted
