GPC3 Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human Glypican 3 (GPC3, also known as GTR2-2, OCI-5 and MXR7). Sequence data: hGPC3 (accession number NP_004475) MAGTVRTACLVVAMLLSLDFPGQAQPPPPPPDATCHQVRSFFQR LQPGLKWVPETPVPGSD
Application Dilute:
Application:. Screen for antibodies of human GPC3 through Flow Cytometry. Culture conditions: Cells should be grown at 37C with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated FBS and
* VAT and and shipping costs not included. Errors and price changes excepted
