B7-H3 Stable Cell Line

Catalog Number: ABI-14-521ACL
Article Name: B7-H3 Stable Cell Line
Biozol Catalog Number: ABI-14-521ACL
Supplier Catalog Number: 14-521ACL
Alternative Catalog Number: ABI-14-521ACL-1VIAL
Manufacturer: Abeomics
Category: Zellen/Zellkultur
Application: FA
B7-H3 Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human B7-H3 (also known as CD276). Sequence data: hB7-H3 (accession number NP_001019907) MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGT DATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQD
Application Dilute: Application:. Screen for antibodies of human B7-H3 through Flow Cytometry. Culture conditions: Cells should be grown at 37C with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated FBS and