A2AR Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human adenosine A2A receptor (A2AR, also known as ADORA2A). Sequence data: hA2AR (accession number AAH13780) MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYF VVSLAAADIAVGVLAIPFAIT
Application Dilute:
Application:. Screen for antibodies of human A2AR through Flow Cytometry. Culture conditions: Cells should be grown at 37C with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated FBS and
* VAT and and shipping costs not included. Errors and price changes excepted