SGLEC5 Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human sialic acid-binding Ig-like lectin 5 (SIGLEC5, also known as CD170). Sequence data: hSIGLEC5 (accession number NP_003821) MLPLLLLPLLWGGSLQEKPVYELQVQKSVTVQEGLCVLVPCSFSY
Application Dilute:
Applicati: Screen for antibodies of human SIGLEC5 through Flow Cytometry. Culture conditions: Cells should be grown at 37C with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated FBS and
* VAT and and shipping costs not included. Errors and price changes excepted
