SGLEC9 Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human sialic acid-binding Ig-like lectin 9 (SIGLEC9, also known as CD329). Sequence data: hSIGLEC9 (accession number NP_055256) MLLLLLPLLWGRERAEGQTSKLLTMQSSVTVQEGLCVHVPCSFSY
Application Dilute:
Application: Screen for antibodies of human SIGLEC9 through Flow Cytometry. Culture conditions: Cells should be grown at 37C with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated FBS an
* VAT and and shipping costs not included. Errors and price changes excepted