C3aR1/NIH 3T3 Stable Cell Line is a stably transfected NIH 3T3 cell line which expresses human Complement component 3a anaphylatoxin chemotactic receptor 1 (C3aR1). Sequence data: hC3aR1 (accession number NP_001313404) MASFSAETNSTDLLSQPWNEPPVILSMVILSLTFL
Application Dilute:
Application: Screen for antibodies of human C3aR1 through Flow Cytometry. Culture conditions: Cells should be grown at 37C with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated FBS and
* VAT and and shipping costs not included. Errors and price changes excepted
