GFP/HeLa Stable Cell Line is a stably transfected HeLa cell line which expresses enhanced green fluorescent protein (eGFP). Sequence data: Amino acid sequence of eGFP MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFIC TTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFK
Application Dilute:
Application:. Screen for GFP through Flow Cytometry. Screen for GFP through Fluorescence Microscopy. Culture conditions: Cells should be grown at 37oC with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10
* VAT and and shipping costs not included. Errors and price changes excepted