FAS (Human) Recombinant Protein

Catalog Number: ABN-H00000355-H01
Article Name: FAS (Human) Recombinant Protein
Biozol Catalog Number: ABN-H00000355-H01
Supplier Catalog Number: H00000355-H01
Alternative Catalog Number: ABN-H00000355-H01-25
Manufacturer: Abnova
Host: Human
Category: Proteine/Peptide
Application: ELISA, SDS-PAGE, WB
Species Reactivity: Human
Purified FAS (AAH12479.1, 25 a.a. - 169 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
Concentration: 10 ug/ml
Tag: His-Flag-StrepII
UniProt: 355
Buffer: 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
Form: Liquid
Sequence: AQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEG
Target: FAS