BCL2A1 (Human) Recombinant Protein (P02)

Catalog Number: ABN-H00000597-P02
Article Name: BCL2A1 (Human) Recombinant Protein (P02)
Biozol Catalog Number: ABN-H00000597-P02
Supplier Catalog Number: H00000597-P02
Alternative Catalog Number: ABN-H00000597-P02-10,ABN-H00000597-P02-25
Manufacturer: Abnova
Category: Proteine/Peptide
Application: AP, Array, ELISA, WB
Species Reactivity: Human
Human BCL2A1 full-length ORF ( NP_004040.1, 1 a.a. - 175 a.a.) recombinant protein with GST-tag at N-terminal.
Tag: GST
UniProt: 597
Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Sequence: MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC
Target: BCL2A1