BMP2 (Human) Recombinant Protein (Q03)
Catalog Number:
ABN-H00000650-Q03
Article Name: |
BMP2 (Human) Recombinant Protein (Q03) |
Biozol Catalog Number: |
ABN-H00000650-Q03 |
Supplier Catalog Number: |
H00000650-Q03 |
Alternative Catalog Number: |
ABN-H00000650-Q03-10,ABN-H00000650-Q03-25 |
Manufacturer: |
Abnova |
Category: |
Proteine/Peptide |
Application: |
AP, Array, ELISA, WB |
Species Reactivity: |
Human |
Human BMP2 partial ORF (NP_001191, 231 a.a. - 330 a.a.) recombinant protein with GST tag at N-terminal. |
Tag: |
GST |
UniProt: |
650 |
Buffer: |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Sequence: |
AHLEEKQGVSKRHVRISRSLHQDEHSWSQIRPLLVTFGHDGKGHPLHKREKRQAKHKQRKRLKSSCKRHPLYVDFSDVGWNDWIVAPPGYHAFYCHGECP |
Target: |
BMP2 |