C11orf10 (Human) Recombinant Protein (P02)
Catalog Number:
ABN-H00000746-P02
| Article Name: |
C11orf10 (Human) Recombinant Protein (P02) |
| Biozol Catalog Number: |
ABN-H00000746-P02 |
| Supplier Catalog Number: |
H00000746-P02 |
| Alternative Catalog Number: |
ABN-H00000746-P02-10,ABN-H00000746-P02-25 |
| Manufacturer: |
Abnova |
| Category: |
Proteine/Peptide |
| Application: |
AP, Array, ELISA, WB |
| Species Reactivity: |
Human |
| Human C11orf10 full-length ORF (NP_055021.1, 1 a.a. - 79 a.a.) recombinant protein with GST tag at N-terminal. |
| Tag: |
GST |
| UniProt: |
746 |
| Buffer: |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Sequence: |
MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVASLFMGFGVLFLLLWVGIYV |
| Target: |
C11orf10 |
