GATA3 (Human) Recombinant Protein (Q02)

Catalog Number: ABN-H00002625-Q02
Article Name: GATA3 (Human) Recombinant Protein (Q02)
Biozol Catalog Number: ABN-H00002625-Q02
Supplier Catalog Number: H00002625-Q02
Alternative Catalog Number: ABN-H00002625-Q02-10,ABN-H00002625-Q02-25
Manufacturer: Abnova
Category: Proteine/Peptide
Application: AP, Array, ELISA, WB
Species Reactivity: Human
Human GATA3 partial ORF ( NP_001002295.1, 103 a.a. - 200 a.a.) recombinant protein with GST-tag at N-terminal.
Tag: GST
UniProt: 2625
Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Sequence: LGSHHTASPWNLSPFSKTSIHHGSPGPLSVYPPASSSSLSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDEKECLKYQVPLPDSMKLESSH
Target: GATA3