HIC1 (Human) Recombinant Protein (Q02)
Catalog Number:
ABN-H00003090-Q02
| Article Name: |
HIC1 (Human) Recombinant Protein (Q02) |
| Biozol Catalog Number: |
ABN-H00003090-Q02 |
| Supplier Catalog Number: |
H00003090-Q02 |
| Alternative Catalog Number: |
ABN-H00003090-Q02-10,ABN-H00003090-Q02-25 |
| Manufacturer: |
Abnova |
| Category: |
Proteine/Peptide |
| Application: |
AP, Array, ELISA, WB |
| Species Reactivity: |
Human |
| Human HIC1 partial ORF ( NP_006488.2, 627 a.a. - 705 a.a.) recombinant protein with GST-tag at N-terminal. |
| Tag: |
GST |
| UniProt: |
3090 |
| Buffer: |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Sequence: |
PEGVFAVARLTAEQLSLKQQDKAAAAELLAQTTHFLHDPKVALESLYPLAKFTAELGLSPDKAAEVLSQGAHLAAGPDG |
| Target: |
HIC1 |
