MT1F (Human) Recombinant Protein (P01)
Catalog Number:
ABN-H00004494-P01
Article Name: |
MT1F (Human) Recombinant Protein (P01) |
Biozol Catalog Number: |
ABN-H00004494-P01 |
Supplier Catalog Number: |
H00004494-P01 |
Alternative Catalog Number: |
ABN-H00004494-P01-10,ABN-H00004494-P01-25 |
Manufacturer: |
Abnova |
Category: |
Proteine/Peptide |
Application: |
AP, Array, ELISA, WB |
Species Reactivity: |
Human |
Human MT1F full-length ORF ( AAH29453, 1 a.a. - 61 a.a.) recombinant protein with GST-tag at N-terminal. |
Tag: |
GST |
UniProt: |
4494 |
Buffer: |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Sequence: |
MDPNCSCAAGVSCTCAGSCKCKECKCTSCKKSCCSCCPVGCSKCAQGCVCKGASEKCSCCD |
Target: |
MT1F |