MYH9 (Human) Recombinant Protein (Q02)

Catalog Number: ABN-H00004627-Q02
Article Name: MYH9 (Human) Recombinant Protein (Q02)
Biozol Catalog Number: ABN-H00004627-Q02
Supplier Catalog Number: H00004627-Q02
Alternative Catalog Number: ABN-H00004627-Q02-10,ABN-H00004627-Q02-25
Manufacturer: Abnova
Category: Proteine/Peptide
Application: AP, Array, ELISA, WB
Species Reactivity: Human
Human MYH9 partial ORF ( NP_002464.1, 1747 a.a. - 1852 a.a.) recombinant protein with GST-tag at N-terminal.
Tag: GST
UniProt: 4627
Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Sequence: LINDRLKKANLQIDQINTDLNLERSHAQKNENARQQLERQNKELKVKLQEMEGTVKSKYKASITALEAKIAQLEEQLDNETKERQAACKQVRRTEKKLKDVLLQVD
Target: MYH9