NRAS (Human) Recombinant Protein (Q01)

Catalog Number: ABN-H00004893-Q01
Article Name: NRAS (Human) Recombinant Protein (Q01)
Biozol Catalog Number: ABN-H00004893-Q01
Supplier Catalog Number: H00004893-Q01
Alternative Catalog Number: ABN-H00004893-Q01-10,ABN-H00004893-Q01-25
Manufacturer: Abnova
Category: Proteine/Peptide
Application: AP, Array, ELISA, WB
Species Reactivity: Human
Human NRAS partial ORF ( AAH05219, 90 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal.
Tag: GST
UniProt: 4893
Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Sequence: FADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM
Target: NRAS