POLR2K (Human) Recombinant Protein (P02)

Catalog Number: ABN-H00005440-P02
Article Name: POLR2K (Human) Recombinant Protein (P02)
Biozol Catalog Number: ABN-H00005440-P02
Supplier Catalog Number: H00005440-P02
Alternative Catalog Number: ABN-H00005440-P02-10,ABN-H00005440-P02-25
Manufacturer: Abnova
Category: Proteine/Peptide
Application: AP, Array, ELISA, WB
Species Reactivity: Human
Human POLR2K full-length ORF ( NP_005025.1, 1 a.a. - 58 a.a.) recombinant protein with GST-tag at N-terminal.
Tag: GST
UniProt: 5440
Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Sequence: MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR
Target: POLR2K