RPS27A (Human) Recombinant Protein (P02)

Catalog Number: ABN-H00006233-P02
Article Name: RPS27A (Human) Recombinant Protein (P02)
Biozol Catalog Number: ABN-H00006233-P02
Supplier Catalog Number: H00006233-P02
Alternative Catalog Number: ABN-H00006233-P02-10,ABN-H00006233-P02-25
Manufacturer: Abnova
Category: Proteine/Peptide
Application: AP, Array, ELISA, WB
Species Reactivity: Human
Human RPS27A full-length ORF (AAH01392, 1 a.a. - 156 a.a.) recombinant protein with GST tag at N-terminal.
Tag: GST
UniProt: 6233
Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Sequence: MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK
Target: RPS27A