SST (Human) Recombinant Protein (Q01)

Catalog Number: ABN-H00006750-Q01
Article Name: SST (Human) Recombinant Protein (Q01)
Biozol Catalog Number: ABN-H00006750-Q01
Supplier Catalog Number: H00006750-Q01
Alternative Catalog Number: ABN-H00006750-Q01-10,ABN-H00006750-Q01-25
Manufacturer: Abnova
Category: Proteine/Peptide
Application: AP, Array, ELISA, WB
Species Reactivity: Human
Human SST partial ORF ( NP_001039, 26 a.a. - 116 a.a.) recombinant protein with GST-tag at N-terminal.
Tag: GST
UniProt: 6750
Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Sequence: PSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC
Target: SST