VDAC1 (Human) Recombinant Protein (Q03)

Catalog Number: ABN-H00007416-Q03
Article Name: VDAC1 (Human) Recombinant Protein (Q03)
Biozol Catalog Number: ABN-H00007416-Q03
Supplier Catalog Number: H00007416-Q03
Alternative Catalog Number: ABN-H00007416-Q03-10,ABN-H00007416-Q03-25
Manufacturer: Abnova
Category: Proteine/Peptide
Application: AP, Array, ELISA, WB
Species Reactivity: Human
Human VDAC1 partial ORF ( AAH08482.1, 156 a.a. - 276 a.a.) recombinant protein with GST-tag at N-terminal.
Tag: GST
UniProt: 7416
Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Sequence: NFETAKSRVTQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNKKLETAVNLAWTAGNSNTRFGIAAKYQIDPDACFSAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLG
Target: VDAC1