VIP (Human) Recombinant Protein (P02)

Catalog Number: ABN-H00007432-P02
Article Name: VIP (Human) Recombinant Protein (P02)
Biozol Catalog Number: ABN-H00007432-P02
Supplier Catalog Number: H00007432-P02
Alternative Catalog Number: ABN-H00007432-P02-10,ABN-H00007432-P02-25
Manufacturer: Abnova
Category: Proteine/Peptide
Application: AP, Array, ELISA, WB
Species Reactivity: Human
Human VIP full-length ORF ( AAH09794.1, 1 a.a. - 169 a.a.) recombinant protein with GST-tag at N-terminal.
Tag: GST
UniProt: 7432
Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Sequence: MDTRNKAQLLVLLTLLSVLFSQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELEK
Target: VIP