XK (Human) Recombinant Protein
Catalog Number:
ABN-H00007504-G01
Article Name: |
XK (Human) Recombinant Protein |
Biozol Catalog Number: |
ABN-H00007504-G01 |
Supplier Catalog Number: |
H00007504-G01 |
Alternative Catalog Number: |
ABN-H00007504-G01-10 |
Manufacturer: |
Abnova |
Category: |
Proteine/Peptide |
Application: |
AP |
Species Reactivity: |
Human |
Human XK full-length ORF (AAH36019.1) recombinant protein without tag.This product is belong to Proteoliposome (PL). |
Tag: |
None |
UniProt: |
7504 |
Buffer: |
25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Form: |
Liquid |
Sequence: |
MKFPASVLASVFLFVAETTAALSLSSTYRSGGDRMWQALTLLFSLLPCALVQLTLLFVHRDLSRDRPLVLLLHLLQLGPLFRCFEVFCIYFQSGNNEEPYVSITKKRQMPKNGLSEEIEKEVGQAEGKLITHRSAFSRASVIQAFLGSAPQLTLQLYISVMQQDVTVGRSLLMTISLLSIVYGALRCNILAIKIKYDEYEVKVKPLAYVCIFLWRSFEIATRVVVLVLFTSVLKTWVVVIILINFFSLFLYPWI |
Target: |
XK |
Application Dilute: |
Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |