TNFRSF10D (Human) Recombinant Protein

Catalog Number: ABN-H00008793-H03
Article Name: TNFRSF10D (Human) Recombinant Protein
Biozol Catalog Number: ABN-H00008793-H03
Supplier Catalog Number: H00008793-H03
Alternative Catalog Number: ABN-H00008793-H03-25
Manufacturer: Abnova
Host: Human
Category: Proteine/Peptide
Application: ELISA, SDS-PAGE, WB
Species Reactivity: Human
Purified TNFRSF10D (AAH52270.1 56 a.a. - 187 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
Concentration: 10 ug/ml
Tag: His-Flag-StrepII
UniProt: 8793
Buffer: 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
Form: Liquid
Sequence: ATIPRQDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNKSSCTTTRDTVCQCEKGSFQDKNSPEMCRTCRTGCPRGMVKVSNCTPRSDIKCKNESAAS
Target: TNFRSF10D