INSL5 (Human) Recombinant Protein (P01)

Catalog Number: ABN-H00010022-P01
Article Name: INSL5 (Human) Recombinant Protein (P01)
Biozol Catalog Number: ABN-H00010022-P01
Supplier Catalog Number: H00010022-P01
Alternative Catalog Number: ABN-H00010022-P01-10,ABN-H00010022-P01-25
Manufacturer: Abnova
Category: Proteine/Peptide
Application: AP, Array, ELISA, WB
Species Reactivity: Human
Human INSL5 full-length ORF ( NP_005469, 1 a.a. - 135 a.a.) recombinant protein with GST-tag at N-terminal.
Tag: GST
UniProt: 10022
Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Sequence: MKGSIFTLFLFSVLFAISEVRSKESVRLCGLEYIRTVIYICASSRWRRHLEGIPQAQQAETGNSFQLPHKREFSEENPAQNLPKVDASGEDRLWGGQMPTEELWKSKKHSVMSRQDLQTLCCTDGCSMTDLSALC
Target: INSL5